| Accession | Acc. Gene-, Name | Start | End | Subsequence | Logic | PDB | Organism | Length | 
|---|---|---|---|---|---|---|---|---|
| ELMI004529 |  Q9UMN6 KMT2B KMT2B_HUMAN  | 
        80 | 126 | LRRLWAGPRVQRGRGRGRGRGWGPSRGCVPEEESSDGESDEEEFQGF | TP | --- | Homo sapiens (Human) | 2715 | 
  Instance evidence
| Evidence class | PSI-MI | Method | BioSource | PubMed | Logic | Reliability | Notes | 
|---|---|---|---|---|---|---|---|
| predicted | MI:0101 | sequence based prediction | in silico | Sharma,2018 | support | likely | InteractionDetection | 
  Interactions 
| Uniprot Id | Domain family | Domain Start | Domain End | Affinity Min/Max (µMol) | Notes | 
|---|---|---|---|---|---|
| (O75475) PSIP1_HUMAN |  IPR021567
                  (Lens epithelium-derived growth factor, integrase-binding domain) 
                  Lens epithelium-derived growth factor (LEDGF), also known as transcriptional co-activator p75, is a chromatin-associated protein that protects cells from stress-induced apoptosis  | 
             349 | 449 | [mitab][xml] | 
    
        Please cite: 
            ELM-the Eukaryotic Linear Motif resource-2024 update.
        
    (PMID:37962385)
    
    
ELM data can be downloaded & distributed for non-commercial use according to the ELM Software License Agreement
ELM data can be downloaded & distributed for non-commercial use according to the ELM Software License Agreement
