LIG_IQ
ELM server details
ELM
blue dot
Functional site class:
Calmodulin binding IQ motif
Functional site description:
The IQ motif is a binding sequence for several calcium-binding proteins, such as the calmodulin (CAM) and CaM-like proteins.
ELM(s): LIG_IQ
LIG_IQ description: Calmodulin binding helical peptide motif
Pattern: ...[SACLIVTM]..[ILVMFCT]Q.{3}[RK].{4,5}[RKQ]..
Present in taxon(s): Eukaryota  Rattus norvegicus  Macaca fascicularis  Caenorhabditis elegans  Monodelphis domestica  Sus scrofa  Cyprinus carpio  Serinus canaria  Drosophila melanogaster  Dictyostelium discoideum  Homo sapiens  Acanthamoeba castellanii  Mus musculus  Bos taurus  Carassius auratus  Gallus gallus  Capra hircus  Argopecten irradians  Macropus eugenii  Schizosaccharomyces pombe  Mesocricetus auratus  Oryctolagus cuniculus  Branchiostoma lanceolatum  Saccharomyces cerevisiae  Papio hamadryas  
Not represented in taxon(s):

o See instances for LIG_IQ


o Abstract

The IQ motif occurs in myosins and non-myosins proteins. It is sequence with the general consensus IQX(3)RGX(3)R. Structural studies show that the IQ motif adopts and alfa-helical conformation, with partial or no amphipathicity with a net positive charge. The motif often occurs as multiple tandem repeats in myosins and in some non-myosins proteins. It is sometimes the target of phosphorylation by PKC or PKA proteins.

o Selected references

Bahler M, Rhoads A
Calmodulin signaling via the IQ motif.
FEBS Lett 2002 Feb 20;513(1) : 107-13.
PMID: 11911888

Cheney RE, Mooseker MS
Unconventional myosins.
Curr Opin Cell Biol 1992 Feb;4(1) : 27-35.
PMID: 1558751

Rhoads AR, Friedberg F
Sequence motifs for calmodulin recognition.
FASEB J 1997 Apr;11(5) : 331-40.
PMID: 9141499

o This ELM has been assigned the following Gene Ontology (GO) terms for biological process, cellular component and molecular function.

Biological Process
  Cell growth and/or maintenance
  signal transduction
  cytoskeletal regulator
Cellular Component
  intracellular
  cytosol
Molecular Function
  Binding
  protein binding
  motor
  muscle motor

 

o Instances for LIG_IQ

SequencePositionSubsequence
(Click for evidence information)
PDBGene NameProtein DescriptionOrganism
MLC1_YEAST 84-102 TKAKTEDFVKAFQVFDKESTGKVSVGDLRY - Name=MLC1; OrderedLocusNames=YGL106W; ORFNames=G3080; Myosin light chain 1 (Myosin-2 light chain) (Calmodulin-like myosin light chain MLC1). Saccharomyces cerevisiae (Baker's yeast).